SCOPe 2.01: Domain d3icba_: 3icb A:

Lineage for d3icba_ (3icb A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.1: Calbindin D9K [47474] (1 protein)
   made of two EF-hands only

6. Protein Calbindin D9K [47475] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47476] (18 PDB entries)
   Uniprot P02633

8. Domain d3icba_: 3icb A: [17147]
   complexed with ca, so4

Details for d3icba_

PDB Entry: 3icb, 2.3 Å

PDB Description: the refined structure of vitamin d-dependent calcium-binding protein from bovine intestine. molecular details, ion binding, and implications for the structure of other calcium-binding proteins

PDB Compounds: (A:) calcium-binding protein

SCOPe Domain Sequences for d3icba_:

Sequence; same for both SEQRES and ATOM records:

>d3icba_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}
kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdge
vsfeefqvlvkkisq

Timeline for d3icba_:

• d3icba_ first appeared (with stable ids) in SCOP 1.55, called d3icb__
  
• d3icba_ appears in SCOP 1.75
  
• d3icba_ appears in SCOPe 2.02
  
• d3icba_ appears in the current release, SCOPe 2.08