Lineage for d2zqca_ (2zqc A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013003Protein beta-Lactamase, class A [56606] (16 species)
  7. 3013155Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (27 PDB entries)
  8. 3013159Domain d2zqca_: 2zqc A: [171425]
    automated match to d1iyqa_
    complexed with azr, so4; mutant

Details for d2zqca_

PDB Entry: 2zqc (more details), 1.07 Å

PDB Description: aztreonam acyl-intermediate structure of class a beta-lactam toho-1 e166a/r274n/r276n triple mutant
PDB Compounds: (A:) beta-lactamase toho-1

SCOPe Domain Sequences for d2zqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqca_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
vtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraql
vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
qkaenrndilaaaakivthgf

SCOPe Domain Coordinates for d2zqca_:

Click to download the PDB-style file with coordinates for d2zqca_.
(The format of our PDB-style files is described here.)

Timeline for d2zqca_: