Lineage for d2zpsa_ (2zps A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794921Protein automated matches [190044] (14 species)
    not a true protein
  7. 1794927Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [189036] (3 PDB entries)
  8. 1794928Domain d2zpsa_: 2zps A: [171409]
    automated match to d1hj8a_
    complexed with ben, ca

Details for d2zpsa_

PDB Entry: 2zps (more details), 1.55 Å

PDB Description: crystal structure of anionic trypsin isoform 3 from chum salmon
PDB Compounds: (A:) anionic trypsin

SCOPe Domain Sequences for d2zpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zpsa_ b.47.1.2 (A:) automated matches {Chum salmon (Oncorhynchus keta) [TaxId: 8018]}
ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyktrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifnnwltstmat

SCOPe Domain Coordinates for d2zpsa_:

Click to download the PDB-style file with coordinates for d2zpsa_.
(The format of our PDB-style files is described here.)

Timeline for d2zpsa_: