SCOPe 2.07: Domain d2zp1a1: 2zp1 A:1-306

Lineage for d2zp1a1 (2zp1 A:1-306)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein automated matches [190581] (10 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [188187] (8 PDB entries)

8. Domain d2zp1a1: 2zp1 A:1-306 [171395]
   Other proteins in same PDB: d2zp1a2
   automated match to d1j1ua_
   complexed with iyr

Details for d2zp1a1

PDB Entry: 2zp1, 1.7 Å

PDB Description: structual basis of iodo-tyrosine recognition by engineered archeal tyrosyl-trna synthetase

PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d2zp1a1:

Sequence; same for both SEQRES and ATOM records:

>d2zp1a1 c.26.1.1 (A:1-306) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mdefemikrntseiiseeelrevlkkdeksayigfepsgkihlghylqikkmidlqnagf
diiilladlaaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvntshylgvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmylknavaeelikile
pirkrl

Timeline for d2zp1a1:

• d2zp1a1 first appeared in SCOPe 2.01, called d2zp1a_
  
• d2zp1a1 appears in SCOPe 2.06
  
• d2zp1a1 appears in the current release, SCOPe 2.08