Lineage for d2zl2i_ (2zl2 I:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460579Protein Clp protease, ClpP subunit [52098] (10 species)
  7. 2460610Species Helicobacter pylori [TaxId:210] [188429] (4 PDB entries)
  8. 2460633Domain d2zl2i_: 2zl2 I: [171334]
    automated match to d1tyfa_

Details for d2zl2i_

PDB Entry: 2zl2 (more details), 2.5 Å

PDB Description: Crystal structure of H.pylori ClpP in complex with the peptide NVLGFTQ
PDB Compounds: (I:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d2zl2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zl2i_ c.14.1.1 (I:) Clp protease, ClpP subunit {Helicobacter pylori [TaxId: 210]}
diysrllkdrivllsgeindsvassivaqllfleaedpekdiglyinspggvitsglsiy
dtmnfirpdvsticigqaasmgafllscgakgkrfslphsrimihqplggaqgqasdiei
isneilrlkglmnsilaqnsgqsleqiakdtdrdfymsakeakeyglidkvlq

SCOPe Domain Coordinates for d2zl2i_:

Click to download the PDB-style file with coordinates for d2zl2i_.
(The format of our PDB-style files is described here.)

Timeline for d2zl2i_: