| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (18 species) not a true protein |
| Species Sulfolobus tokodaii [TaxId:111955] [188428] (1 PDB entry) |
| Domain d2zkid_: 2zki D: [171286] automated match to d2a5la1 complexed with so4 |
PDB Entry: 2zki (more details), 2.9 Å
SCOPe Domain Sequences for d2zkid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkid_ c.23.5.0 (D:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
ckpnilvlfygygsivelakeigkgaeeagaevkirrvretlppefqsripfdkvkdipe
vtlddmrwadgfaigsptrygnmagglktfldttailwkdnvlygkpvtffteastvhgg
hettiltmstyayhfgmiivpigygipelfqtttgggpygathlgskeeldemerkiarf
qgkritevakaikc
Timeline for d2zkid_: