SCOPe 2.07: Domain d2zfea_: 2zfe A:

Lineage for d2zfea_ (2zfe A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)

6. Protein automated matches [190122] (8 species)
   not a true protein

7. Species Halobacterium salinarium [TaxId:2242] [188662] (3 PDB entries)

8. Domain d2zfea_: 2zfe A: [171193]
   automated match to d1cwqa_
   complexed with l1p, l2p, l3p, ret, xe

Details for d2zfea_

PDB Entry: 2zfe, 2.5 Å

PDB Description: crystal structure of bacteriorhodopsin-xenon complex

PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d2zfea_:

Sequence; same for both SEQRES and ATOM records:

>d2zfea_ f.13.1.1 (A:) automated matches {Halobacterium salinarium [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d2zfea_:

• d2zfea_ first appeared in SCOPe 2.01
  
• d2zfea_ appears in SCOPe 2.06
  
• d2zfea_ appears in the current release, SCOPe 2.08