Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.8: Glutaminyl-peptide cyclotransferase-like [142532] (1 protein) part of Pfam PF04389 |
Protein Glutaminyl-peptide cyclotransferase, QPCT [142533] (2 species) Glutaminyl cyclase |
Species Human (Homo sapiens) [TaxId:9606] [142534] (20 PDB entries) Uniprot Q16769 33-361 |
Domain d2zepb_: 2zep B: [171190] automated match to d2afma1 complexed with so4, zn; mutant |
PDB Entry: 2zep (more details), 2.1 Å
SCOPe Domain Sequences for d2zepb_:
Sequence, based on SEQRES records: (download)
>d2zepb_ c.56.5.8 (B:) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]} asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlllipspfpevwhtm ddneenldestidnlnkilqvfvleylhl
>d2zepb_ c.56.5.8 (B:) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]} asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr vfvgatdsavpcammlelaraldkkllslkpdlslqliffdgeeaflhwspqdslygsrh laakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehel helgllkdhslegryfqnysyiqddhipflrrgvpvlllipspfpevwhtmddneenlde stidnlnkilqvfvleylhl
Timeline for d2zepb_: