Lineage for d2zebc_ (2zeb C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1545671Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 1545672Species Human (Homo sapiens) [TaxId:9606] [50547] (13 PDB entries)
  8. 1545699Domain d2zebc_: 2zeb C: [171167]
    automated match to d1a0la_
    complexed with 11m

Details for d2zebc_

PDB Entry: 2zeb (more details), 2.5 Å

PDB Description: Potent, Nonpeptide Inhibitors of Human Mast Cell Tryptase
PDB Compounds: (C:) Tryptase beta 2

SCOPe Domain Sequences for d2zebc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zebc_ b.47.1.2 (C:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d2zebc_:

Click to download the PDB-style file with coordinates for d2zebc_.
(The format of our PDB-style files is described here.)

Timeline for d2zebc_: