Lineage for d2zc6b_ (2zc6 B:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1232775Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1233330Protein automated matches [190161] (15 species)
    not a true protein
  7. 1233438Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [188417] (2 PDB entries)
  8. 1233440Domain d2zc6b_: 2zc6 B: [171149]
    automated match to d2c5wb1
    complexed with teb, zn

Details for d2zc6b_

PDB Entry: 2zc6 (more details), 2.7 Å

PDB Description: penicillin-binding protein 1a (pbp 1a) acyl-enzyme complex (tebipenem) from streptococcus pneumoniae
PDB Compounds: (B:) penicillin-binding protein 1a

SCOPe Domain Sequences for d2zc6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zc6b_ e.3.1.1 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
nypaymdnylkevinqveeetgynllttgmdvytnvdqeaqkhlwdiyntdeyvaypdde
lqvastivdvsngkviaqlgarhqssnvsfginqavetnrdwgstmkpitdyapaleygv
ydstativhdepynypgtntpvynwdrgyfgnitlqyalqqsrnvpavetlnkvglnrak
tflnglgidypsihysnaissnttesdkkygassekmaaayaafanggtyykpmyihkvv
fsdgsekefsnvgtramkettaymmtdmmktvlsygtgqnaylawlpqagktgtsnytde
eienhiktsqfvapdelfagytrkysmavwtgysnrltplvgngltvaakvyrsmmtyls
egsnpedwnipeglyrngefvfkn

SCOPe Domain Coordinates for d2zc6b_:

Click to download the PDB-style file with coordinates for d2zc6b_.
(The format of our PDB-style files is described here.)

Timeline for d2zc6b_: