Lineage for d1lcda_ (1lcd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318756Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2318757Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2319031Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 protein domains)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 2319047Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 2319048Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)
  8. 2319065Domain d1lcda_: 1lcd A: [17111]
    protein/DNA complex; complexed with na

Details for d1lcda_

PDB Entry: 1lcd (more details)

PDB Description: structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics
PDB Compounds: (A:) lac repressor

SCOPe Domain Sequences for d1lcda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcda_ a.35.1.5 (A:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnr

SCOPe Domain Coordinates for d1lcda_:

Click to download the PDB-style file with coordinates for d1lcda_.
(The format of our PDB-style files is described here.)

Timeline for d1lcda_: