Lineage for d1lcca_ (1lcc A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1732999Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1733015Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 1733016Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)
  8. 1733030Domain d1lcca_: 1lcc A: [17110]
    protein/DNA complex; complexed with na

Details for d1lcca_

PDB Entry: 1lcc (more details)

PDB Description: structure of the complex of lac repressor headpiece and an 11 base- pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics
PDB Compounds: (A:) lac repressor

SCOPe Domain Sequences for d1lcca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcca_ a.35.1.5 (A:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnr

SCOPe Domain Coordinates for d1lcca_:

Click to download the PDB-style file with coordinates for d1lcca_.
(The format of our PDB-style files is described here.)

Timeline for d1lcca_: