Lineage for d2z6ua_ (2z6u A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501428Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
    automatically mapped to Pfam PF00145
  6. 2501433Protein DNA methylase HhaI [53367] (2 species)
  7. 2501452Species Haemophilus parahaemolyticus [TaxId:735] [187136] (7 PDB entries)
  8. 2501457Domain d2z6ua_: 2z6u A: [171089]
    automated match to d10mha_
    protein/DNA complex; complexed with sah

Details for d2z6ua_

PDB Entry: 2z6u (more details), 2.72 Å

PDB Description: ternary structure of the glu119ala m.hhai, c5-cytosine dna methyltransferase, with unmodified dna and adohcy
PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2z6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z6ua_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus parahaemolyticus [TaxId: 735]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfman
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOPe Domain Coordinates for d2z6ua_:

Click to download the PDB-style file with coordinates for d2z6ua_.
(The format of our PDB-style files is described here.)

Timeline for d2z6ua_: