SCOPe 2.02: Domain d2z6ca_: 2z6c A:

Lineage for d2z6ca_ (2z6c A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (4 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188508] (1 PDB entry)

8. Domain d2z6ca_: 2z6c A: [171068]
   automated match to d1n9na_
   complexed with fmn

Details for d2z6ca_

PDB Entry: 2z6c, 2.1 Å

PDB Description: Crystal structure of LOV1 domain of phototropin1 from Arabidopsis thaliana

PDB Compounds: (A:) Phototropin-1

SCOPe Domain Sequences for d2z6ca_:

Sequence; same for both SEQRES and ATOM records:

>d2z6ca_ d.110.3.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vsedlkdalstfqqtfvvsdatkpdypimyasagffnmtgytskevvgrncrflqgsgtd
adelakiretlaagnnycgrilnykkdgtsfwnlltiapikdesgkvlkfigmqvevskh
t

Timeline for d2z6ca_:

• d2z6ca_ first appeared in SCOPe 2.01
  
• d2z6ca_ appears in SCOPe 2.03
  
• d2z6ca_ appears in the current release, SCOPe 2.08