Lineage for d1efaa1 (1efa A:2-60)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087132Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1087133Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1087332Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1087347Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 1087348Species Escherichia coli [TaxId:562] [47442] (11 PDB entries)
  8. 1087349Domain d1efaa1: 1efa A:2-60 [17106]
    Other proteins in same PDB: d1efaa2, d1efab2, d1efac2
    protein/DNA complex; complexed with npf

Details for d1efaa1

PDB Entry: 1efa (more details), 2.6 Å

PDB Description: crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf
PDB Compounds: (A:) lac repressor

SCOPe Domain Sequences for d1efaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq

SCOPe Domain Coordinates for d1efaa1:

Click to download the PDB-style file with coordinates for d1efaa1.
(The format of our PDB-style files is described here.)

Timeline for d1efaa1: