Lineage for d2z53a_ (2z53 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441678Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1441679Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1441680Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1441822Protein automated matches [190420] (8 species)
    not a true protein
  7. 1441900Species Phytolacca dioica [TaxId:29725] [188356] (6 PDB entries)
  8. 1441904Domain d2z53a_: 2z53 A: [171051]
    automated match to d1gika_
    complexed with edo; mutant

Details for d2z53a_

PDB Entry: 2z53 (more details), 1.29 Å

PDB Description: crystal structure of the s211a mutant of the ribosome inactivating protein pdl4 from p. dioica leaves
PDB Compounds: (A:) Ribosome-inactivating protein PD-L4

SCOPe Domain Sequences for d2z53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z53a_ d.165.1.1 (A:) automated matches {Phytolacca dioica [TaxId: 29725]}
vntitfdvgnatinkyatfmeslrneakdptlkcygipmlpdsnltpkyvlvklqdassk
titlmlrrnnlyvmgysdlyngkcryhifndisstestdventlcpnsnsrekkainyns
qystlqnkagvssrsqvqlgiqilnsdigkisgvstftdkteaefllvaiqmvseaarfk
yienqvktnfnrafnpnpkvlsleenwgkialaihnakngaltsplelknaddtkwivlr
vdeikpdmgllnyvsgtcqtt

SCOPe Domain Coordinates for d2z53a_:

Click to download the PDB-style file with coordinates for d2z53a_.
(The format of our PDB-style files is described here.)

Timeline for d2z53a_: