PDB entry 2z53

View 2z53 on RCSB PDB site
Description: Crystal structure of the S211A mutant of the ribosome inactivating protein PDL4 from P. dioica leaves
Class: Hydrolase
Keywords: crystal, ribosome inactivating protein, Hydrolase
Deposited on 2007-06-27, released 2008-02-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.138
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome-inactivating protein PD-L4
    Species: Phytolacca dioica [TaxId:29725]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84854 (0-260)
      • engineered (210)
    Domains in SCOPe 2.03: d2z53a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z53A (A:)
    vntitfdvgnatinkyatfmeslrneakdptlkcygipmlpdsnltpkyvlvklqdassk
    titlmlrrnnlyvmgysdlyngkcryhifndisstestdventlcpnsnsrekkainyns
    qystlqnkagvssrsqvqlgiqilnsdigkisgvstftdkteaefllvaiqmvseaarfk
    yienqvktnfnrafnpnpkvlsleenwgkialaihnakngaltsplelknaddtkwivlr
    vdeikpdmgllnyvsgtcqtt