Lineage for d1prua_ (1pru A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1732999Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1733046Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 1733047Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 1733070Domain d1prua_: 1pru A: [17104]

Details for d1prua_

PDB Entry: 1pru (more details)

PDB Description: purine repressor dna-binding domain dna binding
PDB Compounds: (A:) purine repressor

SCOPe Domain Sequences for d1prua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prua_ a.35.1.5 (A:) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]}
matikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkv

SCOPe Domain Coordinates for d1prua_:

Click to download the PDB-style file with coordinates for d1prua_.
(The format of our PDB-style files is described here.)

Timeline for d1prua_: