Lineage for d1pru__ (1pru -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152229Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 152230Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 152326Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 152349Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 152350Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 152373Domain d1pru__: 1pru - [17104]

Details for d1pru__

PDB Entry: 1pru (more details)

PDB Description: purine repressor dna-binding domain dna binding

SCOP Domain Sequences for d1pru__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pru__ a.35.1.5 (-) Purine repressor (PurR), N-terminal domain {Escherichia coli}
matikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkv

SCOP Domain Coordinates for d1pru__:

Click to download the PDB-style file with coordinates for d1pru__.
(The format of our PDB-style files is described here.)

Timeline for d1pru__: