![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
![]() | Protein Purine repressor (PurR), N-terminal domain [47439] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47440] (24 PDB entries) |
![]() | Domain d1qp0a1: 1qp0 A:3-58 [17102] Other proteins in same PDB: d1qp0a2 protein/DNA complex; complexed with hpa |
PDB Entry: 1qp0 (more details), 2.9 Å
SCOPe Domain Sequences for d1qp0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qp0a1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh
Timeline for d1qp0a1: