SCOP 1.61: Domain d2pufa1: 2puf A:3-58

Lineage for d2pufa1 (2puf A:3-58)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families)

5. Family a.35.1.5: Bacterial repressors [47438] (3 proteins)

6. Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)

7. Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)

8. Domain d2pufa1: 2puf A:3-58 [17100]
   Other proteins in same PDB: d2pufa2

Details for d2pufa1

PDB Entry: 2puf, 3 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices

SCOP Domain Sequences for d2pufa1:

Sequence; same for both SEQRES and ATOM records:

>d2pufa1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

Timeline for d2pufa1:

• d2pufa1 first appeared (with stable ids) in SCOP 1.55
  
• d2pufa1 appears in SCOP 1.59
  
• d2pufa1 appears in SCOP 1.63
  
• d2pufa1 appears in the current release, SCOPe 2.08