Lineage for d1qpza1 (1qpz A:2-58)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152229Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 152230Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 152326Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 152349Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 152350Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 152364Domain d1qpza1: 1qpz A:2-58 [17097]
    Other proteins in same PDB: d1qpza2

Details for d1qpza1

PDB Entry: 1qpz (more details), 2.5 Å

PDB Description: purine repressor-hypoxanthine-palindromic operator complex

SCOP Domain Sequences for d1qpza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

SCOP Domain Coordinates for d1qpza1:

Click to download the PDB-style file with coordinates for d1qpza1.
(The format of our PDB-style files is described here.)

Timeline for d1qpza1:

152364
d1qpza1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1qpza2