SCOPe 2.05: Domain d2z0vb_: 2z0v B:

Lineage for d2z0vb_ (2z0v B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.1: BAR domain [103658] (4 proteins)
   sensor of membrane curvature

6. Protein automated matches [190594] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187606] (4 PDB entries)

8. Domain d2z0vb_: 2z0v B: [170962]
   automated match to d1x03a1

Details for d2z0vb_

PDB Entry: 2z0v, 2.49 Å

PDB Description: Crystal structure of BAR domain of Endophilin-III

PDB Compounds: (B:) SH3-containing GRB2-like protein 3

SCOPe Domain Sequences for d2z0vb_:

Sequence, based on SEQRES records:

>d2z0vb_ a.238.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddefldmerkidvtnkvvaeilsktteylqpnpayraklgmlntvskirgqvkttgypqt
egllgdcmlkygkelgedstfgnalievgesmklmaevkdsldinvkqtfidplqllqdk
dlkeighhlkklegrrldydykkkrvgkipdeevrqavekfeeskelaersmfnflendv
eqvsqlavfieaaldyhrqsteilqelqsklqmrisaassvprre

Sequence, based on observed residues (ATOM records):

>d2z0vb_ a.238.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddefldmerkidvtnkvvaeilsktteylqpnpayraklgmlntvskirgqvkttgypqt
egllgdcmlkygkelgedstfgnalievgesmklmaevkdsldinvkqtfidplqllqdk
dlkeighhlkklegrrldydykkkrvgeevrqavekfeeskelaersmfnflendveqvs
qlavfieaaldyhrqsteilqelqsklqmrisaassvprre

Timeline for d2z0vb_:

• d2z0vb_ first appeared in SCOPe 2.01
  
• d2z0vb_ appears in SCOPe 2.04
  
• d2z0vb_ appears in SCOPe 2.06
  
• d2z0vb_ appears in the current release, SCOPe 2.08