Lineage for d1qp4a1 (1qp4 A:3-58)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97149Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 97150Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 97246Family a.35.1.5: Bacterial repressors [47438] (3 proteins)
  6. 97267Protein Purine repressor (PurR), N-terminal domain [47439] (1 species)
  7. 97268Species Escherichia coli [TaxId:562] [47440] (24 PDB entries)
  8. 97281Domain d1qp4a1: 1qp4 A:3-58 [17096]
    Other proteins in same PDB: d1qp4a2

Details for d1qp4a1

PDB Entry: 1qp4 (more details), 3 Å

PDB Description: purine repressor-hypoxanthine-palindromic operator complex

SCOP Domain Sequences for d1qp4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp4a1 a.35.1.5 (A:3-58) Purine repressor (PurR), N-terminal domain {Escherichia coli}
tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnh

SCOP Domain Coordinates for d1qp4a1:

Click to download the PDB-style file with coordinates for d1qp4a1.
(The format of our PDB-style files is described here.)

Timeline for d1qp4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qp4a2