SCOPe 2.01: Domain d2z0ka_: 2z0k A:

Lineage for d2z0ka_ (2z0k A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
   core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet

4. Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families)

5. Family d.116.1.0: automated matches [191417] (1 protein)
   not a true family

6. Protein automated matches [190578] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [188266] (3 PDB entries)

8. Domain d2z0ka_: 2z0k A: [170956]
   automated match to d1wdva_
   protein/RNA complex; complexed with a5a

Details for d2z0ka_

PDB Entry: 2z0k, 2.2 Å

PDB Description: Crystal structure of ProX-AlaSA complex from T. thermophilus

PDB Compounds: (A:) Putative uncharacterized protein TTHA1699

SCOPe Domain Sequences for d2z0ka_:

Sequence; same for both SEQRES and ATOM records:

>d2z0ka_ d.116.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
lspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgayl
flvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedllg
ypevwaaggtpralfratpkellaltgaqvadlkeg

Timeline for d2z0ka_:

• d2z0ka_ is new in SCOPe 2.01-stable
  
• d2z0ka_ appears in SCOPe 2.02
  
• d2z0ka_ appears in the current release, SCOPe 2.08