SCOPe 2.07: Domain d2z0ac1: 2z0a C:1-71

Lineage for d2z0ac1 (2z0a C:1-71)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein automated matches [190929] (8 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [188439] (2 PDB entries)

8. Domain d2z0ac1: 2z0a C:1-71 [170950]
   Other proteins in same PDB: d2z0ac2
   automated match to d1ns1a_
   complexed with gly, sin

Details for d2z0ac1

PDB Entry: 2z0a, 1.85 Å

PDB Description: Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)

PDB Compounds: (C:) nonstructural protein 1

SCOPe Domain Sequences for d2z0ac1:

Sequence; same for both SEQRES and ATOM records:

>d2z0ac1 a.16.1.1 (C:1-71) automated matches {Influenza A virus, different strains [TaxId: 11320]}
mdpntvssfqvdcflwhvrkrladqelgdapfldrlrrdqkslrgrgntlgldietatra
gkqiverilee

Timeline for d2z0ac1:

• d2z0ac1 first appeared in SCOPe 2.01, called d2z0ac_
  
• d2z0ac1 appears in SCOPe 2.06
  
• d2z0ac1 appears in the current release, SCOPe 2.08