Class a: All alpha proteins [46456] (289 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) |
Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
Protein automated matches [190929] (8 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [188439] (2 PDB entries) |
Domain d2z0ac1: 2z0a C:1-71 [170950] Other proteins in same PDB: d2z0ac2 automated match to d1ns1a_ complexed with gly, sin |
PDB Entry: 2z0a (more details), 1.85 Å
SCOPe Domain Sequences for d2z0ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z0ac1 a.16.1.1 (C:1-71) automated matches {Influenza A virus, different strains [TaxId: 11320]} mdpntvssfqvdcflwhvrkrladqelgdapfldrlrrdqkslrgrgntlgldietatra gkqiverilee
Timeline for d2z0ac1: