Lineage for d1dwkj1 (1dwk J:1-86)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354938Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 354939Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 355020Family a.35.1.4: Cyanase N-terminal domain [47435] (1 protein)
    probably does not bind to DNA
  6. 355021Protein Cyanase N-terminal domain [47436] (1 species)
  7. 355022Species Escherichia coli [TaxId:562] [47437] (2 PDB entries)
  8. 355042Domain d1dwkj1: 1dwk J:1-86 [17084]
    Other proteins in same PDB: d1dwka2, d1dwkb2, d1dwkc2, d1dwkd2, d1dwke2, d1dwkf2, d1dwkg2, d1dwkh2, d1dwki2, d1dwkj2
    complexed with oxl, so4

Details for d1dwkj1

PDB Entry: 1dwk (more details), 1.65 Å

PDB Description: structure of cyanase with the di-anion oxalate bound at the enzyme active site

SCOP Domain Sequences for d1dwkj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwkj1 a.35.1.4 (J:1-86) Cyanase N-terminal domain {Escherichia coli}
miqsqinrnirldladaillskakkdlsfaeiadgtglaeafvtaallgqqalpadaarl
vgakldldedsilllqmiplrgcidd

SCOP Domain Coordinates for d1dwkj1:

Click to download the PDB-style file with coordinates for d1dwkj1.
(The format of our PDB-style files is described here.)

Timeline for d1dwkj1: