Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) |
Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
Protein automated matches [190485] (8 species) not a true protein |
Species Leiurus quinquestriatus [TaxId:6884] [187842] (2 PDB entries) |
Domain d2yeoa_: 2yeo A: [170767] automated match to d1lqha_ complexed with cl, dr0, dr8, edo; mutant |
PDB Entry: 2yeo (more details), 1.08 Å
SCOPe Domain Sequences for d2yeoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yeoa_ g.3.7.1 (A:) automated matches {Leiurus quinquestriatus [TaxId: 6884]} mvrdayiaknyncvyecfrdaycnelctkngassgycqwlgkygnacwcyalpdnvpirv pgkcr
Timeline for d2yeoa_: