Lineage for d2yc0a_ (2yc0 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963404Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 963548Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (2 proteins)
  6. 963562Protein automated matches [190145] (1 species)
    not a true protein
  7. 963563Species Human (Homo sapiens) [TaxId:9606] [186870] (13 PDB entries)
  8. 963568Domain d2yc0a_: 2yc0 A: [170733]
    automated match to d1iz3a_
    complexed with 2hg, fe2, gol, so4

Details for d2yc0a_

PDB Entry: 2yc0 (more details), 2.15 Å

PDB Description: factor inhibiting hif-1 alpha in complex with r-2-hydroxyglutarate
PDB Compounds: (A:) Hypoxia-inducible factor 1-alpha inhibitor

SCOPe Domain Sequences for d2yc0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yc0a_ b.82.2.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn

SCOPe Domain Coordinates for d2yc0a_:

Click to download the PDB-style file with coordinates for d2yc0a_.
(The format of our PDB-style files is described here.)

Timeline for d2yc0a_: