![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (2 proteins) |
![]() | Protein automated matches [190145] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186870] (13 PDB entries) |
![]() | Domain d2yc0a_: 2yc0 A: [170733] automated match to d1iz3a_ complexed with 2hg, fe2, gol, so4 |
PDB Entry: 2yc0 (more details), 2.15 Å
SCOPe Domain Sequences for d2yc0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yc0a_ b.82.2.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
Timeline for d2yc0a_: