Lineage for d2yaza_ (2yaz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753119Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. 1753120Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. 1753198Family a.204.1.0: automated matches [191410] (1 protein)
    not a true family
  6. 1753199Protein automated matches [190562] (4 species)
    not a true protein
  7. 1753203Species Leishmania major [TaxId:5664] [187550] (4 PDB entries)
  8. 1753210Domain d2yaza_: 2yaz A: [170712]
    automated match to d1ogla_
    complexed with mg, so4, ump

Details for d2yaza_

PDB Entry: 2yaz (more details), 2.4 Å

PDB Description: the crystal structure of leishmania major dutpase in complex dump
PDB Compounds: (A:) dutpase

SCOPe Domain Sequences for d2yaza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yaza_ a.204.1.0 (A:) automated matches {Leishmania major [TaxId: 5664]}
nipgailhslaelqdglnamidpswravrsldnwalaitmestelldsypwkwwknlnat
pdlanvrielvdifhfslsgamqmrstpddeipaaslkplkevmttflpakectsdpygf
vffpltdtqnaiasfrniiqlanayrfdviieciiyaaedlgfnlvayyiakhtlncirq
lsgykdgsyvkvnngvednsllhncikdvsldevldadkyvqawnsimanvyeafqikes
drkdaerwfalakenrl

SCOPe Domain Coordinates for d2yaza_:

Click to download the PDB-style file with coordinates for d2yaza_.
(The format of our PDB-style files is described here.)

Timeline for d2yaza_: