Lineage for d2y8gb_ (2y8g B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551147Family b.55.1.3: Ran-binding domain [50764] (5 proteins)
  6. 1551168Protein automated matches [191227] (1 species)
    not a true protein
  7. 1551169Species Human (Homo sapiens) [TaxId:9606] [189645] (2 PDB entries)
  8. 1551171Domain d2y8gb_: 2y8g B: [170696]
    automated match to d2crfa1
    complexed with so4; mutant

Details for d2y8gb_

PDB Entry: 2y8g (more details), 1.61 Å

PDB Description: structure of the ran-binding domain from human ranbp3 (e352a-r353v double mutant)
PDB Compounds: (B:) ran-binding protein 3

SCOPe Domain Sequences for d2y8gb_:

Sequence, based on SEQRES records: (download)

>d2y8gb_ b.55.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aesnvlqmqcklfvfdktsqswvavgrgllrlndmastddgtlqsrlvmrtqgslrliln
tklwaqmqidkaseksiritamdtedqgvkvflisasskdtgqlyaalhhrilalrsrve
q

Sequence, based on observed residues (ATOM records): (download)

>d2y8gb_ b.55.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aesnvlqmqcklfvfdktsqswvavgrgllrlndmastddgtlqsrlvmrtqgslrliln
tklwaqmqidkaseksiritamdtqgvkvflisasskdtgqlyaalhhrilalrsrveq

SCOPe Domain Coordinates for d2y8gb_:

Click to download the PDB-style file with coordinates for d2y8gb_.
(The format of our PDB-style files is described here.)

Timeline for d2y8gb_: