| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein automated matches [190047] (29 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189700] (1 PDB entry) |
| Domain d2y8ea_: 2y8e A: [170689] automated match to d1yzqa1 complexed with gnp, mg, so4 |
PDB Entry: 2y8e (more details), 1.39 Å
SCOPe Domain Sequences for d2y8ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y8ea_ c.37.1.8 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdta
gqerfrslipsyirdstvavvvyditntnsfhqtskwiddvrtergsdviimlvgnktdl
sdkrqvsteegerkakelnvmfietsakagynvkqlfrrvaaalp
Timeline for d2y8ea_: