Lineage for d2y69g_ (2y69 G:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059440Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 1059441Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 1059488Protein automated matches [191230] (1 species)
    not a true protein
  7. 1059489Species Cow (Bos taurus) [TaxId:9913] [189651] (1 PDB entry)
  8. 1059490Domain d2y69g_: 2y69 G: [170638]
    Other proteins in same PDB: d2y69a_, d2y69c_, d2y69h_, d2y69i_, d2y69l_, d2y69n_, d2y69p_, d2y69u_, d2y69v_, d2y69y_
    automated match to d1occg_
    complexed with chd, cu, cua, dmu, hea, mg, oxy, pek, pgv, zn

Details for d2y69g_

PDB Entry: 2y69 (more details), 1.95 Å

PDB Description: bovine heart cytochrome c oxidase re-refined with molecular oxygen
PDB Compounds: (G:) cytochrome c oxidase polypeptide 6a2

SCOPe Domain Sequences for d2y69g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y69g_ f.23.2.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d2y69g_:

Click to download the PDB-style file with coordinates for d2y69g_.
(The format of our PDB-style files is described here.)

Timeline for d2y69g_: