SCOPe 2.07: Domain d2y5ca1: 2y5c A:4-109

Lineage for d2y5ca1 (2y5c A:4-109)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189894] (1 PDB entry)

8. Domain d2y5ca1: 2y5c A:4-109 [170608]
   Other proteins in same PDB: d2y5ca2, d2y5cb2
   automated match to d1l6ua_
   complexed with fes, so4

Details for d2y5ca1

PDB Entry: 2y5c, 1.7 Å

PDB Description: Structure of human ferredoxin 2 (Fdx2)in complex with 2Fe2S cluster

PDB Compounds: (A:) adrenodoxin-like protein, mitochondrial

SCOPe Domain Sequences for d2y5ca1:

Sequence; same for both SEQRES and ATOM records:

>d2y5ca1 d.15.4.0 (A:4-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvnvvfvdrsgqripvsgrvgdnvlhlaqrhgvdlegaceaslacstchvyvsedhldl
lpppeereddmldmapllqensrlgcqivltpelegaeftlpkitr

Timeline for d2y5ca1:

• d2y5ca1 first appeared in SCOPe 2.01, called d2y5ca_
  
• d2y5ca1 appears in SCOPe 2.06
  
• d2y5ca1 appears in the current release, SCOPe 2.08