Lineage for d2xyrb_ (2xyr B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643467Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
    binds two zinc ion per subunit; forms a dodecameric shell
  4. 2643468Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) (S)
    automatically mapped to Pfam PF09401
  5. 2643469Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
    partly covered by PfamB PB001266
  6. 2643521Protein automated matches [191249] (4 species)
    not a true protein
  7. 2643537Species SARS coronavirus [TaxId:227859] [189770] (4 PDB entries)
  8. 2643541Domain d2xyrb_: 2xyr B: [170488]
    automated match to d2g9ta1
    complexed with cl, mg, na, sfg, zn

Details for d2xyrb_

PDB Entry: 2xyr (more details), 2.5 Å

PDB Description: crystal structure of the nsp16 nsp10 sars coronavirus complex
PDB Compounds: (B:) non-structural protein 10

SCOPe Domain Sequences for d2xyrb_:

Sequence, based on SEQRES records: (download)

>d2xyrb_ g.86.1.1 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
tvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfgga
scclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcscd

Sequence, based on observed residues (ATOM records): (download)

>d2xyrb_ g.86.1.1 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
tvlsfcafavdpakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfgga
scclycrchidhpncdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcscd

SCOPe Domain Coordinates for d2xyrb_:

Click to download the PDB-style file with coordinates for d2xyrb_.
(The format of our PDB-style files is described here.)

Timeline for d2xyrb_: