Class a: All alpha proteins [46456] (179 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) |
Family a.35.1.2: Phage repressors [47419] (6 proteins) consists of different sequence families of HTH repressors of phage origins |
Protein cro lambda repressor [47428] (1 species) the fourth helix is replaced with a beta hairpin 3 helices; folded leaf, opened |
Species Bacteriophage lambda [TaxId:10710] [47429] (9 PDB entries) |
Domain d6croa_: 6cro A: [17047] protein/DNA complex; complexed with so4 |
PDB Entry: 6cro (more details), 3 Å
SCOP Domain Sequences for d6croa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6croa_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda} eqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsn
Timeline for d6croa_: