Lineage for d2xrsd_ (2xrs D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788379Protein Heat-labile toxin [50205] (2 species)
  7. 2788380Species Escherichia coli, type IB [TaxId:562] [50206] (23 PDB entries)
  8. 2788416Domain d2xrsd_: 2xrs D: [170323]
    automated match to d1djrd_
    complexed with gal

Details for d2xrsd_

PDB Entry: 2xrs (more details), 1.81 Å

PDB Description: crystal structures exploring the origins of the broader specificity of escherichia coli heat-labile enterotoxin compared to cholera toxin
PDB Compounds: (D:) heat-labile enterotoxin b chain

SCOPe Domain Sequences for d2xrsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xrsd_ b.40.2.1 (D:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOPe Domain Coordinates for d2xrsd_:

Click to download the PDB-style file with coordinates for d2xrsd_.
(The format of our PDB-style files is described here.)

Timeline for d2xrsd_: