![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) ![]() |
![]() | Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
![]() | Protein lambda C1 repressor, DNA-binding domain [47420] (1 species) |
![]() | Species Bacteriophage lambda [TaxId:10710] [47421] (4 PDB entries) |
![]() | Domain d1lmb4_: 1lmb 4: [17024] protein/DNA complex |
PDB Entry: 1lmb (more details), 1.8 Å
SCOP Domain Sequences for d1lmb4_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lmb4_ a.35.1.2 (4:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay naallakilkvsveefspsiareiyemyeavs
Timeline for d1lmb4_: