PDB entry 1lmb

View 1lmb on RCSB PDB site
Description: refined 1.8 angstrom crystal structure of the lambda repressor-operator complex
Class: transcription/DNA
Keywords: protein-DNA complex, double helix
Deposited on 1991-11-05, released 1991-11-05
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: DNA (5'-d(*ap*ap*tp*ap*cp*cp*ap*cp*tp*gp*gp*cp*gp*gp*tp*gp*a p*tp*ap*t)-3')
  • Chain '2':
    Compound: DNA (5'-d(*tp*ap*tp*ap*tp*cp*ap*cp*cp*gp*cp*cp*ap*gp*tp*gp*g p*tp*ap*t)-3')
  • Chain '3':
    Compound: protein (lambda repressor)
    Species: Bacteriophage lambda
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lmb3_
  • Chain '4':
    Compound: protein (lambda repressor)
    Species: Bacteriophage lambda
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lmb4_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1lmb3 (3:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lmb3 (3:)
    pltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnaynaall
    akilkvsveefspsiareiyemyeavs
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lmb4 (4:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavs