Lineage for d1au7b2 (1au7 B:5-74)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087132Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1087133Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1087134Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 1087150Protein Pit-1 [47417] (1 species)
  7. 1087151Species Norway rat (Rattus norvegicus) [TaxId:10116] [47418] (1 PDB entry)
  8. 1087153Domain d1au7b2: 1au7 B:5-74 [17022]
    Other proteins in same PDB: d1au7a1, d1au7b1
    protein/DNA complex; mutant

Details for d1au7b2

PDB Entry: 1au7 (more details), 2.3 Å

PDB Description: pit-1 mutant/dna complex
PDB Compounds: (B:) protein pit-1

SCOPe Domain Sequences for d1au7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1au7b2 a.35.1.1 (B:5-74) Pit-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gmraleqfanefkvrriklgytqtnvgealaavhgsefsqtticrfenlqlsfknacklk
ailskwleea

SCOPe Domain Coordinates for d1au7b2:

Click to download the PDB-style file with coordinates for d1au7b2.
(The format of our PDB-style files is described here.)

Timeline for d1au7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1au7b1