SCOPe 2.08: Domain d2xlce_: 2xlc E:

Lineage for d2xlce_ (2xlc E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
   Pfam PF05448; AXE1

6. Protein automated matches [191114] (2 species)
   not a true protein

7. Species Bacillus pumilus [TaxId:1408] [189177] (6 PDB entries)

8. Domain d2xlce_: 2xlc E: [170212]
   automated match to d1odtc_
   complexed with dep

Details for d2xlce_

PDB Entry: 2xlc, 2.7 Å

PDB Description: acetyl xylan esterase from bacillus pumilus cect5072 bound to paraoxon

PDB Compounds: (E:) acetyl xylan esterase

SCOPe Domain Sequences for d2xlce_:

Sequence; same for both SEQRES and ATOM records:

>d2xlce_ c.69.1.25 (E:) automated matches {Bacillus pumilus [TaxId: 1408]}
sleelkkykpkktarpdfadfwkksleelrqveaeptlesydypvkgvkvyrltyqsfgh
skiegfyavpdqtgphpalvrfhgynasyddgihdivnwalhgyatfgmlvrgqggsedt
svtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggsqggal
aiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpeveekafetls
yfdlinlagwvkqptlmaiglidqvtppstvfaaynhletdkelkvyryfghefipafqt
eklsflqkhlll

Timeline for d2xlce_:

• d2xlce_ first appeared in SCOPe 2.01
  
• d2xlce_ appears in SCOPe 2.07