Lineage for d1odtc_ (1odt C:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
Pfam PF05448; AXE1
Protein Cephalosporin C deacetylase [82505] (1 species) Species Bacillus subtilis [TaxId:1423] [82506] (3 PDB entries) 
Domain d1odtc_: 1odt C: [86885]
complexed with act
Details for d1odtc_
PDB Entry: 1odt (more details), 1.7 Å
PDB Description: cephalosporin c deacetylase mutated, in complex with acetate
PDB Compounds: (C:) Cephalosporin C deacetylaseSCOPe Domain Sequences for d1odtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1odtc_ c.69.1.25 (C:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}
mqlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlt
yksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgq
qssedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtgg
aqgggltiaaaalsdipkaavadypylsnferaidvaleepyleinsffrrngspetevq
amktlsyfdimnladrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfghey
ipafqteklaffkqhlk
SCOPe Domain Coordinates for d1odtc_:
Click to download the PDB-style file with coordinates for d1odtc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1odtc_:
- d1odtc_ first appeared in SCOP 1.65
- d1odtc_ appears in SCOPe 2.07
View in 3D
