SCOPe 2.08: Domain d1poua_: 1pou A:

Lineage for d1poua_ (1pou A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.1: POU-specific domain [47414] (3 proteins)

6. Protein Oct-1 [47415] (1 species)
   canonical 4-helical fold

7. Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)

8. Domain d1poua_: 1pou A: [17020]

Details for d1poua_

PDB Entry: 1pou

PDB Description: the solution structure of the oct-1 pou-specific domain reveals a striking similarity to the bacteriophage lambda repressor dna-binding domain

PDB Compounds: (A:) oct-1

SCOPe Domain Sequences for d1poua_:

Sequence; same for both SEQRES and ATOM records:

>d1poua_ a.35.1.1 (A:) Oct-1 {Human (Homo sapiens) [TaxId: 9606]}
dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
pllekwlndae

Timeline for d1poua_:

• d1poua_ first appeared (with stable ids) in SCOP 1.55, called d1pou__
  
• d1poua_ appears in SCOPe 2.07