Lineage for d2xkqh_ (2xkq H:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911056Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 911282Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries)
  8. 911374Domain d2xkqh_: 2xkq H: [170189]
    automated match to d1umng_
    complexed with ca, cl, epe, mn3

Details for d2xkqh_

PDB Entry: 2xkq (more details), 2.4 Å

PDB Description: crystal structure of streptococcus suis dpr with manganese
PDB Compounds: (H:) DNA protection during starvation protein

SCOPe Domain Sequences for d2xkqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xkqh_ a.25.1.1 (H:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
svtndifnvakasiekhiwmlqaelgqapkl

SCOPe Domain Coordinates for d2xkqh_:

Click to download the PDB-style file with coordinates for d2xkqh_.
(The format of our PDB-style files is described here.)

Timeline for d2xkqh_: