Lineage for d2xjnd_ (2xjn D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1084174Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1084505Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1084731Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries)
  8. 1084759Domain d2xjnd_: 2xjn D: [170149]
    automated match to d1umng_
    complexed with ca, cl, cu, epe

Details for d2xjnd_

PDB Entry: 2xjn (more details), 2.1 Å

PDB Description: crystal structure of streptococcus suis dpr with copper
PDB Compounds: (D:) DNA protection during starvation protein

SCOPe Domain Sequences for d2xjnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xjnd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
svtndifnvakasiekhiwmlqaelgqapkl

SCOPe Domain Coordinates for d2xjnd_:

Click to download the PDB-style file with coordinates for d2xjnd_.
(The format of our PDB-style files is described here.)

Timeline for d2xjnd_: