Lineage for d2xd9a_ (2xd9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857936Protein automated matches [190071] (6 species)
    not a true protein
  7. 2857980Species Helicobacter pylori [TaxId:210] [187015] (7 PDB entries)
  8. 2857983Domain d2xd9a_: 2xd9 A: [170040]
    automated match to d1j2ya_
    complexed with xd9

Details for d2xd9a_

PDB Entry: 2xd9 (more details), 1.95 Å

PDB Description: structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2xd9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xd9a_ c.23.13.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqe

SCOPe Domain Coordinates for d2xd9a_:

Click to download the PDB-style file with coordinates for d2xd9a_.
(The format of our PDB-style files is described here.)

Timeline for d2xd9a_: