Lineage for d1j2ya_ (1j2y A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857823Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 2857862Species Helicobacter pylori [TaxId:210] [89598] (1 PDB entry)
  8. 2857863Domain d1j2ya_: 1j2y A: [84047]
    complexed with dqa

Details for d1j2ya_

PDB Entry: 1j2y (more details), 2.6 Å

PDB Description: Crystal structure of the type II 3-dehydroquinase
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d1j2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2ya_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqeaqknn

SCOPe Domain Coordinates for d1j2ya_:

Click to download the PDB-style file with coordinates for d1j2ya_.
(The format of our PDB-style files is described here.)

Timeline for d1j2ya_: