Lineage for d2xcec_ (2xce C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139618Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1139747Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1139908Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1139909Protein automated matches [191182] (2 species)
    not a true protein
  7. 1139910Species Bacillus subtilis [TaxId:1423] [189439] (5 PDB entries)
  8. 1139916Domain d2xcec_: 2xce C: [170028]
    automated match to d1sixa_
    complexed with ca, dup, gol

Details for d2xcec_

PDB Entry: 2xce (more details), 1.85 Å

PDB Description: Structure of YncF in complex with dUpNHpp
PDB Compounds: (C:) probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf

SCOPe Domain Sequences for d2xcec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xcec_ b.85.4.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
velvevehl

SCOPe Domain Coordinates for d2xcec_:

Click to download the PDB-style file with coordinates for d2xcec_.
(The format of our PDB-style files is described here.)

Timeline for d2xcec_: