Lineage for d1b0na1 (1b0n A:74-108)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47298Fold a.34: SinR repressor dimerisation domain-like [47405] (1 superfamily)
  4. 47299Superfamily a.34.1: SinR repressor dimerisation domain-like [47406] (1 family) (S)
  5. 47300Family a.34.1.1: SinR repressor dimerisation domain-like [47407] (2 proteins)
  6. 47319Protein SinR repressor (dimerisation domain)-SinI anti-repressor complex [47408] (1 species)
  7. 47320Species Bacillus subtilis [TaxId:1423] [47409] (1 PDB entry)
  8. 47321Domain d1b0na1: 1b0n A:74-108 [17001]
    Other proteins in same PDB: d1b0na2

Details for d1b0na1

PDB Entry: 1b0n (more details), 1.9 Å

PDB Description: sinr protein/sini protein complex

SCOP Domain Sequences for d1b0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0na1 a.34.1.1 (A:74-108) SinR repressor (dimerisation domain)-SinI anti-repressor complex {Bacillus subtilis}
ldseweklvrdamtsgvskkqfrefldyqkwrksq

SCOP Domain Coordinates for d1b0na1:

Click to download the PDB-style file with coordinates for d1b0na1.
(The format of our PDB-style files is described here.)

Timeline for d1b0na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0na2
View in 3D
Domains from other chains:
(mouse over for more information)
d1b0nb1