| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.34: Dimerisation interlock [47405] (4 superfamilies) 4 helices; bundle, closed, right-handed twist |
Superfamily a.34.1: SinR repressor dimerisation domain-like [47406] (1 family) ![]() intertwined heterodimer of two homologous chains |
| Family a.34.1.1: SinR repressor dimerisation domain-like [47407] (3 proteins) |
| Protein SinR repressor dimerisation domain [88841] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [88842] (1 PDB entry) |
| Domain d1b0na1: 1b0n A:74-108 [17001] Other proteins in same PDB: d1b0na2, d1b0nb_ CASP3; complexed with SinI anti-repressor complexed with zn fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1b0n (more details), 1.9 Å
SCOPe Domain Sequences for d1b0na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b0na1 a.34.1.1 (A:74-108) SinR repressor dimerisation domain {Bacillus subtilis [TaxId: 1423]}
ldseweklvrdamtsgvskkqfrefldyqkwrksq
Timeline for d1b0na1: